Immunofluorescence staining of axon initial segments in adult rat cortex with N106/36 (red) and bIV- spectrin rabbit polyclonal (green). Image courtesy of Matt Rasband (Baylor College of Medicine).

Immunofluorescence staining of axon initial segments in adult rat cortex with N106/36 (red) and bIV- spectrin rabbit polyclonal (green). Image courtesy of Matt Rasband (Baylor College of Medicine).

Immunofluorescence staining of nodes of Ranvier in adult rat optic nerve with N106/36 (red) and Caspr rabbit polyclonal (green). Image courtesy of Matt Rasband (Baylor College of Medicine).

Immunofluorescence staining of nodes of Ranvier in adult rat optic nerve with N106/36 (red) and Caspr rabbit polyclonal (green). Image courtesy of Matt Rasband (Baylor College of Medicine).

adult rat Cortex immunohistochemistry of axon initial segments.

adult rat Cortex immunohistochemistry of axon initial segments.

Adult rat thalamus immunohistochemistry of axon initial segments.

Adult rat thalamus immunohistochemistry of axon initial segments.

from NeuroMab

Ankyrin-G (Staining) (7x-146)

  • Sale
  • Regular price $325



Product Details | ↓ Citations



Volume: Purified: 100 µL; Purified Trial: 20 µL; TC Supernatant: 5 mL

Concentration: Purified: 1 mg/mL; TC Supernatant: Lot Specific

Clonality: Monoclonal

Form: Purified and TC Supernatant Available (select your preferred form, size and quantity before clicking "Add to Cart")

Host Species: Mouse

Immunogen: Fusion protein ~1000 amino acids of Ankyrin-G (also known as ANK-3 or ankyrin-3), sequence: EDAMTGDTDKYLGPQDLKELGDDSLPAEGYMGFSLGARSASLRSFSSDRS YTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTL DNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRI TCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSM RGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKK RICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGA LTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTI PVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIK DCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKM NDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCY GNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKT TKGLPQTAVCNLNITLPAHKKIEKTDRRQSFASLALRKRYSYLTEPGMSP QSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQ SFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGT RSFADENNVFHDPVDDGPPVVTAEDASLEDSKLEDSVPLTEMPEAVDVDE SQLENVCLSWQNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSY LKGEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQSTKETLKPKIHGS GHVEEPASPLAAYQKSLEETSKLIIEETKPCVPVSMKKMSRTSPADGKPR LSLHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKAH Human: 92% identity (920/994 amino acids identical, accession # E9PE32) Mouse: 89% identity (837/936 amino acids identical) Rat: 87% identity (820/935 amino acids identical) 50% identity with Ankyrin-B

Target Description: Ankyrin-G (ankyrin 3) is a member of the Ankyrin family which consists of Ankyrin R (1), Ankyrin B (2) and Ankyrin G (3) all of which are expressed in the nervous system. Ankyrins are structural proteins that aid in the attachment of integral membrane proteins with the spectrin-actin cytoskeleton, and thus targets voltage-gated sodium channels, potassium channels, cell adhesion molecules and others at the nodes of Ranvier and axonal initial segments (AIS). Variants in Ankyrin G have been linked to bipolar disorder.

Gene ID: ANK3

Antibody Registry ID (RRID): AB_10673030

Physical State: Liquid

NOTE

Aves Labs products are intended for use as research laboratory reagents. They are not intended for use as diagnostic or therapeutic reagents in humans.


back to top


Citations


back to top