Volume: Purified: 100 µL; Purified Trial: 20 µL; TC Supernatant: 5 mL
Concentration: Purified: 1 mg/mL; TC Supernatant: Lot Specific
Clonality: Monoclonal
Form: Purified and TC Supernatant Available (select your preferred form, size and quantity before clicking "Add to Cart")
Host Species: Mouse
Immunogen: Fusion protein ~1000 amino acids of Ankyrin-G (also known as ANK-3 or ankyrin-3), sequence: EDAMTGDTDKYLGPQDLKELGDDSLPAEGYMGFSLGARSASLRSFSSDRS YTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTL DNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRI TCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSM RGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKK RICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGA LTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTI PVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIK DCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKM NDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCY GNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKT TKGLPQTAVCNLNITLPAHKKIEKTDRRQSFASLALRKRYSYLTEPGMSP QSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQ SFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGT RSFADENNVFHDPVDDGPPVVTAEDASLEDSKLEDSVPLTEMPEAVDVDE SQLENVCLSWQNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSY LKGEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQSTKETLKPKIHGS GHVEEPASPLAAYQKSLEETSKLIIEETKPCVPVSMKKMSRTSPADGKPR LSLHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKAH Human: 92% identity (920/994 amino acids identical, accession # E9PE32) Mouse: 89% identity (837/936 amino acids identical) Rat: 87% identity (820/935 amino acids identical) 50% identity with Ankyrin-B
Target Description: Ankyrin-G (ankyrin 3) is a member of the Ankyrin family which consists of Ankyrin R (1), Ankyrin B (2) and Ankyrin G (3) all of which are expressed in the nervous system. Ankyrins are structural proteins that aid in the attachment of integral membrane proteins with the spectrin-actin cytoskeleton, and thus targets voltage-gated sodium channels, potassium channels, cell adhesion molecules and others at the nodes of Ranvier and axonal initial segments (AIS). Variants in Ankyrin G have been linked to bipolar disorder.
Gene ID: ANK3
Antibody Registry ID (RRID): AB_10673030
Physical State: Liquid
NOTE
Aves Labs products are intended for use as research laboratory reagents. They are not intended for use as diagnostic or therapeutic reagents in humans.
Citations
- Serwanski DR, Jukkola P, Nishiyama A. (2017), 'Heterogeneity of astrocyte and NG2 cell insertion at the node of ranvier..' Journal of Comparative Neurology. 10.1002/cne.24083.
- Sun Y, Paşca SP, Portmann T, Goold C, Worringer KA, Guan W, Chan KC, Gai H, Vogt D, Chen YJ, Mao R, Chan K, Rubenstein JL, Madison DV, Hallmayer J, Froehlich-Santino WM, Bernstein JA, Dolmetsch RE. (2016), 'A deleterious Nav1.1 mutation selectively impairs telencephalic inhibitory neurons derived from Dravet Syndrome patients..' Elife. 10.7554/eLife.13073.
- Patzke C, Acuna C, Giam LR, Wernig M, Südhof TC. (2016), 'Conditional deletion of L1CAM in human neurons impairs both axonal and dendritic arborization and action potential generation..' Journal of Experimental Medicine. 10.1084/jem.20150951.
- Franssen EH, Zhao RR, Koseki H, Kanamarlapudi V, Hoogenraad CC, Eva R, Fawcett JW. (2016), 'Exclusion of integrins from CNS axons is regulated by Arf6 activation and the AIS..' Journal of Neuroscience. 10.1523/JNEUROSCI.2850-14.2015.
- Varea O, Martin-de-Saavedra MD, Kopeikina KJ, Schürmann B, Fleming HJ, Fawcett-Patel JM, Bach A, Jang S, Peles E, Kim E, Penzes P. (2015), 'Synaptic abnormalities and cytoplasmic glutamate receptor aggregates in contactin associated protein-like 2/Caspr2 knockout neurons..' Proceedings of the National Academy of Science of the United States of America. 10.1073/pnas.1423205112.
- Chang KJ, Zollinger DR, Susuki K, Sherman DL, Makara MA, Brophy PJ, Cooper EC, Bennett V, Mohler PJ, Rasband MN. (2014), 'Glial ankyrins facilitate paranodal axoglial junction assembly..' Nature Neuroscience. 10.1038/nn.3858.
- Kaphzan H, Buffington SA, Ramaraj AB, Lingrel JB, Rasband MN, Santini E, Klann E. (2013), 'Genetic reduction of the α1 subunit of Na/K-ATPase corrects multiple hippocampal phenotypes in Angelman syndrome..' Cell Report. 10.1016/j.celrep.2013.07.005.
- Ottolini M, Barker BS, Gaykema RP, Meisler MH, Patel MK. (2017), 'Aberrant Sodium Channel Currents and Hyperexcitability of Medial Entorhinal Cortex Neurons in a Mouse Model of SCN8A Encephalopathy..' Journal of Neuroscience. 10.1523/JNEUROSCI.2709-16.2017.
- Sohn PD, Tracy TE, Son HI, Zhou Y, Leite RE, Miller BL, Seeley WW, Grinberg LT, Gan L, (2016), 'Acetylated tau destabilizes the cytoskeleton in the axon initial segment and is mislocalized to the somatodendritic compartment..' Molecular Neurodegeneration. 10.1186/s13024-016-0109-0.
- Hivert B, Pinatel D, Labasque M, Tricaud N, Goutebroze L, Faivre-Sarrailh C. (2016), 'Assembly of juxtaparanodes in myelinating DRG culture: Differential clustering of the Kv1/Caspr2 complex and scaffolding protein 4.1B..' Glia. 10.1002/glia.22968.
- Brügger V, Engler S, Pereira JA, Ruff S, Horn M, Welzl H, Münger E, Vaquié A, Sidiropoulos PN, Egger B, Yotovski P, Filgueira L, Somandin C, Lühmann TC, D'Antonio M, Yamaguchi T, Matthias P, Suter U, Jacob C. (2016), 'HDAC1/2-Dependent P0 Expression Maintains Paranodal and Nodal Integrity Independently of Myelin Stability through Interactions with Neurofascins..' PLoS Biology. 10.1371/journal.pbio.1002258.
- Gong X, Zhang L, Huang T, Lin TV, Miyares L, Wen J, Hsieh L, Bordey A. (2015), 'Activating the translational repressor 4E-BP or reducing S6K-GSK3β activity prevents accelerated axon growth induced by hyperactive mTOR in vivo..' Human Molecular Genetics. 10.1093/hmg/ddv295.
- Abidi A, Devaux JJ, Molinari F, Alcaraz G, Michon FX, Sutera-Sardo J, Becq H, Lacoste C, Altuzarra C, Afenjar A, Mignot C, Doummar D, Isidor B, Guyen SN, Colin E, De La Vaissière S, Haye D, Trauffler A, Badens C, Prieur F, Lesca G, Villard L, Milh M, Aniksztejn L. (2015), 'A recurrent KCNQ2 pore mutation causing early onset epileptic encephalopathy has a moderate effect on M current but alters subcellular localization of Kv7 channels..' Neurobiology of Disease. 10.1016/j.nbd.2015.04.017.
- Horschitz S, Matthäus F, Groß A, Rosner J, Galach M, Greffrath W, Treede RD, Utikal J, Schloss P, Meyer-Lindenberg A. (2015), 'Impact of preconditioning with retinoic acid during early development on morphological and functional characteristics of human induced pluripotent stem cell-derived neurons..' Stem Cell Research. 10.1016/j.scr.2015.04.007.
- Papandréou MJ, Vacher H, Fache MP, Klingler E, Rueda-Boroni F, Ferracci G, Debarnot C, Pipéroglou C, Garcia Del Caño G, Goutebroze L, Dargent B. (2015), 'CK2-regulated schwannomin-interacting protein IQCJ-SCHIP-1 association with AnkG contributes to the maintenance of the axon initial segment..' Journal of Neurochemistry. 10.1111/jnc.13158.
- Bosch MK, Carrasquillo Y, Ransdell JL, Kanakamedala A, Ornitz DM, Nerbonne JM. (2015), 'Intracellular FGF14 (iFGF14) Is Required for Spontaneous and Evoked Firing in Cerebellar Purkinje Neurons and for Motor Coordination and Balance..' Journal of Neuroscience. 10.1523/JNEUROSCI.2663-14.2015.
- Akin EJ, Solé L, Dib-Hajj SD, Waxman SG, Tamkun MM. (2015), 'Preferential targeting of Nav1.6 voltage-gated Na+ Channels to the axon initial segment during development..' PLoS One. 10.1371/journal.pone.0124397.
- Liu Y, Lee JW, Ackerman SL. (2015), 'Mutations in the microtubule-associated protein 1A (Map1a) gene cause Purkinje cell degeneration..' Journal of Neuroscience. 10.1523/JNEUROSCI.2757-14.2015.
- Baalman K, Marin MA, Ho TS, Godoy M, Cherian L, Robertson C, Rasband MN. (2015), 'Axon initial segment-associated microglia..' Journal of Neuroscience. 10.1523/JNEUROSCI.3751-14.2015.
- Chand AN, Galliano E, Chesters RA, Grubb MS. (2015), 'A distinct subtype of dopaminergic interneuron displays inverted structural plasticity at the axon initial segment..' Journal of Neuroscience. 10.1523/JNEUROSCI.3515-14.2015.
- Freeman SA, Desmazières A, Simonnet J, Gatta M, Pfeiffer F, Aigrot MS, Rappeneau Q, Guerreiro S, Michel PP, Yanagawa Y, Barbin G, Brophy PJ, Fricker D, Lubetzki C, Sol-Foulon N. (2015), 'Acceleration of conduction velocity linked to clustering of nodal components precedes myelination..' Proceedings of the National Academy of Science of the United States of America. 10.1073/pnas.1419099112.
- Wimmer VC, Harty RC, Richards KL, Phillips AM, Miyazaki H, Nukina N, Petrou S. (2015), 'Sodium channel β1 subunit localizes to axon initial segments of excitatory and inhibitory neurons and shows regional heterogeneity in mouse brain..' Journal of Comparative Neurology. 10.1002/cne.23715.
- Ho TS, Zollinger DR, Chang KJ, Xu M, Cooper EC, Stankewich MC, Bennett V, Rasband MN. (2014), 'A hierarchy of ankyrin-spectrin complexes clusters sodium channels at nodes of Ranvier..' Nature Neuroscience. 10.1038/nn.3859.
- Komulainen E, Zdrojewska J, Freemantle E, Mohammad H, Kulesskaya N, Deshpande P, Marchisella F, Mysore R, Hollos P, Michelsen KA, Mågard M, Rauvala H, James P, Coffey ET. (2014), 'JNK1 controls dendritic field size in L2/3 and L5 of the motor cortex, constrains soma size, and influences fine motor coordination..' Frontiers in Neuroscience. 10.3389/fncel.2014.00272.
- Thome C, Kelly T, Yanez A, Schultz C, Engelhardt M, Cambridge SB, Both M, Draguhn A, Beck H, Egorov AV. (2014), 'Axon-carrying dendrites convey privileged synaptic input in hippocampal neurons..' Neuron. 10.1016/j.neuron.2014.08.013.
- Bosch MK, Nerbonne JM, Ornitz DM. (2014), 'Dual transgene expression in murine cerebellar Purkinje neurons by viral transduction in vivo..' PLoS One. 10.1371/journal.pone.0104062.
- Cavaretta JP, Sherer KR, Lee KY, Kim EH, Issema RS, Chung HJ. (2014), 'Polarized axonal surface expression of neuronal KCNQ potassium channels is regulated by calmodulin interaction with KCNQ2 subunit..' PLoS One. 10.1371/journal.pone.0103655.
- Muir J, Kittler JT. (2014), 'Plasticity of GABAA receptor diffusion dynamics at the axon initial segment..' Frontiers in Neuroscience. 10.3389/fncel.2014.00151.
- Hochbaum DR, Zhao Y, Farhi SL, Klapoetke N, Werley CA, Kapoor V, Zou P, Kralj JM, Maclaurin D, Smedemark-Margulies N, Saulnier JL, Boulting GL, Straub C, Cho YK, Melkonian M, Wong GK, Harrison DJ, Murthy VN, Sabatini BL, Boyden ES, Campbell RE, Cohen AE. (2014), 'All-optical electrophysiology in mammalian neurons using engineered microbial rhodopsins..' Nature Methods. 10.1038/nmeth.3000.
- Montersino A, Brachet A, Ferracci G, Fache MP, Angles d'Ortoli S, Liu W, Rueda-Boroni F, Castets F, Dargent B. (2014), 'Tetrodotoxin-resistant voltage-gated sodium channel Nav 1.8 constitutively interacts with ankyrin G..' Journal of Neurochemistry. 10.1111/jnc.12785.
- Shy D, Gillet L, Ogrodnik J, Albesa M, Verkerk AO, Wolswinkel R, Rougier JS, Barc J, Essers MC, Syam N, Marsman RF, van Mil AM, Rotman S, Redon R, Bezzina CR, Remme CA, Abriel H. (2014), 'PDZ domain-binding motif regulates cardiomyocyte compartment-specific NaV1.5 channel expression and function..' Circulation. 10.1161/CIRCULATIONAHA.113.007852.
- Rowan MJ, Tranquil E, Christie JM. (2014), 'Distinct Kv channel subtypes contribute to differences in spike signaling properties in the axon initial segment and presynaptic boutons of cerebellar interneurons..' Journal of Neuroscience. 10.1523/JNEUROSCI.4208-13.2014.
- Amor V, Feinberg K, Eshed-Eisenbach Y, Vainshtein A, Frechter S, Grumet M, Rosenbluth J, Peles E. (2014), 'Long-term maintenance of Na+ channels at nodes of Ranvier depends on glial contact mediated by gliomedin and NrCAM..' Journal of Neuroscience. 10.1523/JNEUROSCI.4752-13.2014.
- Desmazieres A, Zonta B, Zhang A, Wu LM, Sherman DL, Brophy PJ. (2014), 'Differential stability of PNS and CNS nodal complexes when neuronal neurofascin is lost..' Journal of Neuroscience. 10.1523/JNEUROSCI.4662-13.2014.
- Jones SL, Korobova F, Svitkina T. (2014), 'Axon initial segment cytoskeleton comprises a multiprotein submembranous coat containing sparse actin filaments..' The Journal of Biology. 10.1083/jcb.201401045.
- Gutzmann A, Ergül N, Grossmann R, Schultz C, Wahle P, Engelhardt M. (2014), 'A period of structural plasticity at the axon initial segment in developing visual cortex..' Frontiers in Neuroanatomy. 10.3389/fnana.2014.00011.
- Balasanyan V, Arnold DB. (2014), 'Actin and myosin-dependent localization of mRNA to dendrites..' PLoS One. 10.1371/journal.pone.0092349.
- Del Puerto A, Fronzaroli-Molinieres L, Perez-Alvarez MJ, Giraud P, Carlier E, Wandosell F, Debanne D, Garrido JJ. (2015), 'ATP-P2X7 Receptor Modulates Axon Initial Segment Composition and Function in Physiological Conditions and Brain Injury..' Cereb Cortex. 10.1093/cercor/bhu035.
- Kirizs T, Kerti-Szigeti K, Lorincz A, Nusser Z. (2014), 'Distinct axo-somato-dendritic distributions of three potassium channels in CA1 hippocampal pyramidal cells..' European Journal of Neuroscience. 10.1111/ejn.12526.
- Battefeld A, Tran BT, Gavrilis J, Cooper EC, Kole MH. (2014), 'Heteromeric Kv7.2/7.3 channels differentially regulate action potential initiation and conduction in neocortical myelinated axons..' Journal of Neuroscience. 10.1523/JNEUROSCI.4206-13.2014.
- King AN, Manning CF, Trimmer JS. (2014), 'A unique ion channel clustering domain on the axon initial segment of mammalian neurons..' Journal of Comparative Neurology. 10.1002/cne.23551.
- Li Q, Zheng S, Han A, Lin CH, Stoilov P, Fu XD, Black DL. (2014), 'The splicing regulator PTBP2 controls a program of embryonic splicing required for neuronal maturation..' Elife. 10.7554/eLife.01201.
- Bodi I, Curran O, Selway R, Elwes R, Burrone J, Laxton R, Al-Sarraj S, Honavar M. (2014), 'Two cases of multinodular and vacuolating neuronal tumour..' Acta Neuropathol Commun.. 10.1186/2051-5960-2-7.
- Barry J, Gu Y, Jukkola P, O'Neill B, Gu H, Mohler PJ, Rajamani KT, Gu C. (2014), 'Ankyrin-G directly binds to kinesin-1 to transport voltage-gated Na+ channels into axons..' Developmental Cell. 10.1016/j.devcel.2013.11.023.
- Antón-Fernández A, Rubio-Garrido P, DeFelipe J, Muñoz A. (2014), 'Selective presence of a giant saccular organelle in the axon initial segment of a subpopulation of layer V pyramidal neurons..' Brian Structure and Function. 10.1007/s00429-013-0689-1.
- Forro T, Valenti O, Lasztoczi B, Klausberger T. (2015), 'Temporal organization of GABAergic interneurons in the intermediate CA1 hippocampus during network oscillations..' Cereb Cortex. 10.1093/cercor/bht316.
- Forro T, Valenti O, Lasztoczi B, Klausberger T. (2013), 'Membrane domain organization of myelinated axons requires βII spectrin..' The Journal of Biology. 10.1093/cercor/bht316.
- Viney TJ, Lasztoczi B, Katona L, Crump MG, Tukker JJ, Klausberger T, Somogyi P. (2013), 'Network state-dependent inhibition of identified hippocampal CA3 axo-axonic cells in vivo..' Nature Neuroscience. 10.1038/nn.3550.
- Puthussery T, Venkataramani S, Gayet-Primo J, Smith RG, Taylor WR. (2013), 'NaV1.1 channels in axon initial segments of bipolar cells augment input to magnocellular visual pathways in the primate retina..' Journal of Neuroscience. 10.1523/JNEUROSCI.1249-13.2013.
- Green JA, Yang J, Grati M, Kachar B, Bhat MA. (2013), 'Whirlin, a cytoskeletal scaffolding protein, stabilizes the paranodal region and axonal cytoskeleton in myelinated axons..' BMC Neuroscience. 10.1186/1471-2202-14-96.
- Xiao M, Bosch MK, Nerbonne JM, Ornitz DM. (2013), 'FGF14 localization and organization of the axon initial segment..' Molecular and Cellular Neuroscience. 10.1016/j.mcn.2013.07.008.
- Miron VE, Boyd A, Zhao JW, Yuen TJ, Ruckh JM, Shadrach JL, van Wijngaarden P, Wagers AJ, Williams A, Franklin RJM, Ffrench-Constant C. (2013), 'M2 microglia and macrophages drive oligodendrocyte differentiation during CNS remyelination..' Nature Neuroscience. 10.1038/nn.3469.
- Hargus NJ, Nigam A, Bertram EH rd, Patel MK. (2013), 'Evidence for a role of Nav1.6 in facilitating increases in neuronal hyperexcitability during epileptogenesis..' Journal of Neurophysiology. 10.1152/jn.00383.2013.
- Evans MD, Sammons RP, Lebron S, Dumitrescu AS, Watkins TB, Uebele VN, Renger JJ, Grubb MS. (2013), 'Calcineurin signaling mediates activity-dependent relocation of the axon initial segment..' Journal of Neuroscience. 10.1523/JNEUROSCI.0277-13.2013.
- Buffington SA, Rasband MN. (2013), 'Na+ channel-dependent recruitment of Navβ4 to axon initial segments and nodes of Ranvier..' Journal of Neuroscience. 10.1523/JNEUROSCI.4051-12.2013.
- Vadhvani M, Schwedhelm-Domeyer N, Mukherjee C, Stegmüller J. (2013), 'The centrosomal E3 ubiquitin ligase FBXO31-SCF regulates neuronal morphogenesis and migration..' PLoS One. 10.1371/journal.pone.0057530.
- Inan M, Blázquez-Llorca L, Merchán-Pérez A, Anderson SA, DeFelipe J, Yuste R. (2013), 'Dense and overlapping innervation of pyramidal neurons by chandelier cells..' Journal of Neuroscience. 10.1523/JNEUROSCI.4049-12.2013.
- Sánchez-Ponce D, DeFelipe J, Garrido JJ, Muñoz A. (2012), 'Developmental expression of Kv potassium channels at the axon initial segment of cultured hippocampal neurons..' PLoS One. 10.1371/journal.pone.0048557.
- Hong M, Bao L, Kefaloyianni E, Agullo-Pascual E, Chkourko H, Foster M, Taskin E, Zhandre M, Reid DA, Rothenberg E, Delmar M, Coetzee WA. (2012), 'Heterogeneity of ATP-sensitive K+ channels in cardiac myocytes: enrichment at the intercalated disk..' The Journal of Biological Chemistry. 10.1074/jbc.M112.412122.
- Baalman KL, Cotton RJ, Rasband SN, Rasband MN. (2013), 'Blast wave exposure impairs memory and decreases axon initial segment length..' Journal of Neurotrauma. 10.1089/neu.2012.2478.
- Engelhardt M, Vorwald S, Sobotzik JM, Bennett V, Schultz C. (2013), 'Ankyrin-B structurally defines terminal microdomains of peripheral somatosensory axons..' Brian Structure and Function. 10.1007/s00429-012-0443-0.
- Tapia M, Del Puerto A, Puime A, Sánchez-Ponce D, Fronzaroli-Molinieres L, Pallas-Bazarra N, Carlier E, Giraud P, Debanne D, Wandosell F, Garrido JJ. (2013), 'GSK3 and β-catenin determines functional expression of sodium channels at the axon initial segment..' Cell Mol Life Sciences. 10.1007/s00018-012-1059-5.
- Manning CF, Bundros AM, Trimmer JS. (2012), 'Benefits and pitfalls of secondary antibodies: why choosing the right secondary is of primary importance..' PLoS One. 10.1371/journal.pone.0038313.
- Yap CC, Vakulenko M, Kruczek K, Motamedi B, Digilio L, Liu JS, Winckler B. (2012), 'Doublecortin (DCX) mediates endocytosis of neurofascin independently of microtubule binding..' Journal of Neuroscience. 10.1523/JNEUROSCI.5318-11.2012.
- Galiano MR, Jha S, Ho TS, Zhang C, Ogawa Y, Chang KJ, Stankewich MC, Mohler PJ, Rasband MN. (2012), 'A distal axonal cytoskeleton forms an intra-axonal boundary that controls axon initial segment assembly..' Cell. 10.1016/j.cell.2012.03.039.
- Gasser A, Ho TS, Cheng X, Chang KJ, Waxman SG, Rasband MN, Dib-Hajj SD. (2012), 'An ankyrinG-binding motif is necessary and sufficient for targeting Nav1.6 sodium channels to axon initial segments and nodes of Ranvier..' Journal of Neuroscience. 10.1523/JNEUROSCI.5434-11.2012.
- Buffington SA, Sobotzik JM, Schultz C, Rasband MN. (2012), 'IκBα is not required for axon initial segment assembly..' Molecular and Cellular Neuroscience. 10.1016/j.mcn.2012.03.003.
- Chen X, Lepier A, Berninger B, Tolkovsky AM, Herbert J. (2012), 'Cultured subventricular zone progenitor cells transduced with neurogenin-2 become mature glutamatergic neurons and integrate into the dentate gyrus..' PLoS One. 10.1371/journal.pone.0031547.
- León-Espinosa G, DeFelipe J, Muñoz A. (2012), 'Effects of amyloid-β plaque proximity on the axon initial segment of pyramidal cells..' Journal of Alzheimer's Disease. 10.3233/JAD-2012-112036.
- Kaphzan H, Buffington SA, Jung JI, Rasband MN, Klann E. (2011), 'Alterations in intrinsic membrane properties and the axon initial segment in a mouse model of Angelman syndrome..' Journal of Neuroscience. 10.1523/JNEUROSCI.4162-11.2011.
- Damiani D, Novelli E, Mazzoni F, Strettoi E. (2012), 'Undersized dendritic arborizations in retinal ganglion cells of the rd1 mutant mouse: a paradigm of early onset photoreceptor degeneration..' Journal of Comparative Neurology. 10.1002/cne.22802.
- Wu C, Ivanova E, Cui J, Lu Q, Pan ZH. (2011), 'Action potential generation at an axon initial segment-like process in the axonless retinal AII amacrine cell..' Journal of Neuroscience. 10.1523/JNEUROSCI.1861-11.2011.
- Sánchez-Ponce D, Blázquez-Llorca L, DeFelipe J, Garrido JJ, Muñoz A. (2012), 'Colocalization of α-actinin and synaptopodin in the pyramidal cell axon initial segment..' Cereb Cortex. 10.1093/cercor/bhr251.
- Lysakowski A, Gaboyard-Niay S, Calin-Jageman I, Chatlani S, Price SD, Eatock RA. (2011), 'Molecular microdomains in a sensory terminal, the vestibular calyx ending..' Journal of Neuroscience. 10.1523/JNEUROSCI.0521-11.2011.
- Brandao KE, Dell'Acqua ML, Levinson SR. (2012), 'A-kinase anchoring protein 150 expression in a specific subset of TRPV1- and CaV 1.2-positive nociceptive rat dorsal root ganglion neurons..' Journal of Comparative Neurology. 10.1002/cne.22692.
- Binder E, Rukavina M, Hassani H, Weber M, Nakatani H, Reiff T, Parras C, Taylor V, Rohrer H. (2011), 'Peripheral nervous system progenitors can be reprogrammed to produce myelinating oligodendrocytes and repair brain lesions..' Journal of Neuroscience. 10.1523/JNEUROSCI.0129-11.2011.
- Lewis TL Jr, Mao T, Arnold DB. (2011), 'A role for myosin VI in the localization of axonal proteins..' PLoS Biology. 10.1371/journal.pbio.1001021.
- Zonta B, Desmazieres A, Rinaldi A, Tait S, Sherman DL, Nolan MF, Brophy PJ. (2011), 'A critical role for Neurofascin in regulating action potential initiation through maintenance of the axon initial segment..' Neuron. 10.1016/j.neuron.2011.02.021.
- Vacher H, Yang JW, Cerda O, Autillo-Touati A, Dargent B, Trimmer JS. (2011), 'Cdk-mediated phosphorylation of the Kvβ2 auxiliary subunit regulates Kv1 channel axonal targeting..' The Journal of Biology. 10.1083/jcb.201007113.
- Hargus NJ, Merrick EC, Nigam A, Kalmar CL, Baheti AR, Bertram EH rd, Patel MK. (2011), 'Temporal lobe epilepsy induces intrinsic alterations in Na channel gating in layer II medial entorhinal cortex neurons..' Neurobiology of Disease. 10.1016/j.nbd.2010.10.004.
- Sanchez-Ponce D, Muñoz A, Garrido JJ. (2011), 'Casein kinase 2 and microtubules control axon initial segment formation..' Molecular and Cellular Neuroscience. 10.1016/j.mcn.2010.09.005.
- Grubb MS, Burrone J. (2010), 'Activity-dependent relocation of the axon initial segment fine-tunes neuronal excitability..' Nature. 10.1038/nature09160.
- Lorincz A, Nusser Z. (2010), 'Molecular identity of dendritic voltage-gated sodium channels..' Science. 10.1126/science.1187958.